Lineage for d1wiga2 (1wig A:33-67)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035745Protein Actin-binding LIM protein 2, abLIM2 [111441] (1 species)
  7. 3035746Species Human (Homo sapiens) [TaxId:9606] [111442] (2 PDB entries)
    Uniprot Q6H8Q1 73-140, 212-271
  8. 3035750Domain d1wiga2: 1wig A:33-67 [114671]
    Other proteins in same PDB: d1wiga3, d1wiga4
    Structural genomics target; 1st LIM domain
    complexed with zn

Details for d1wiga2

PDB Entry: 1wig (more details)

PDB Description: solution structure of rsgi ruh-019, a lim domain of actin binding lim protein 2 (kiaa1808 protein) from human cdna
PDB Compounds: (A:) KIAA1808 protein

SCOPe Domain Sequences for d1wiga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiga2 g.39.1.3 (A:33-67) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]}
lcvrcgqmfaegeemylqgssiwhpacrqaarted

SCOPe Domain Coordinates for d1wiga2:

Click to download the PDB-style file with coordinates for d1wiga2.
(The format of our PDB-style files is described here.)

Timeline for d1wiga2: