SCOP 1.71: Domain d1wifa_: 1wif A:

Lineage for d1wifa_ (1wif A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (35 proteins)
   Pfam 00595

6. Protein hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) [117184] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117185] (1 PDB entry)

8. Domain d1wifa_: 1wif A: [114669]
   Structural genomics target

Details for d1wifa_

PDB Entry: 1wif

PDB Description: the solution structure of rsgi ruh-020, a pdz domain of hypothetical protein from mouse

SCOP Domain Sequences for d1wifa_:

Sequence; same for both SEQRES and ATOM records:

>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus)}
gssgssgsknekeqlskakasvsslnkviqtkltvgnlglglvviqngpylqishlinkg
aaasdgilqpgdvlisvghanvlgytlreflkllqnitigtvlqikayrgfleipqewqd
sgpssg

Timeline for d1wifa_:

• d1wifa_ is new in SCOP 1.71
  
• d1wifa_ appears in SCOP 1.73
  
• d1wifa_ appears in the current release, SCOPe 2.08, called d1wifa1