Lineage for d1wifa1 (1wif A:8-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785961Protein hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) [117184] (1 species)
  7. 2785962Species Mouse (Mus musculus) [TaxId:10090] [117185] (1 PDB entry)
    Uniprot Q9CR71 8-120
  8. 2785963Domain d1wifa1: 1wif A:8-120 [114669]
    Other proteins in same PDB: d1wifa2, d1wifa3
    Structural genomics target

Details for d1wifa1

PDB Entry: 1wif (more details)

PDB Description: the solution structure of rsgi ruh-020, a pdz domain of hypothetical protein from mouse
PDB Compounds: (A:) RIKEN cDNA 4930408O21

SCOPe Domain Sequences for d1wifa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wifa1 b.36.1.1 (A:8-120) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]}
sknekeqlskakasvsslnkviqtkltvgnlglglvviqngpylqishlinkgaaasdgi
lqpgdvlisvghanvlgytlreflkllqnitigtvlqikayrgfleipqewqd

SCOPe Domain Coordinates for d1wifa1:

Click to download the PDB-style file with coordinates for d1wifa1.
(The format of our PDB-style files is described here.)

Timeline for d1wifa1: