Lineage for d1wiea1 (1wie A:8-90)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783216Protein RIM binding protein 2, RIMBP2 [117149] (1 species)
  7. 2783217Species Human (Homo sapiens) [TaxId:9606] [117150] (2 PDB entries)
    Uniprot O15034 160-242
  8. 2783219Domain d1wiea1: 1wie A:8-90 [114668]
    Other proteins in same PDB: d1wiea2, d1wiea3
    Structural genomics target
    has additional insertions and/or extensions that are not grouped together

Details for d1wiea1

PDB Entry: 1wie (more details)

PDB Description: solution structure of the first sh3 domain of kiaa0318 protein
PDB Compounds: (A:) RIM binding protein 2

SCOPe Domain Sequences for d1wiea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiea1 b.34.2.1 (A:8-90) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]}
tskqrysgkvhlcvarysynpfdgpnenpeaelpltagkylyvygdmdedgfyegelldg
qrglvpsnfvdfvqdnesrlast

SCOPe Domain Coordinates for d1wiea1:

Click to download the PDB-style file with coordinates for d1wiea1.
(The format of our PDB-style files is described here.)

Timeline for d1wiea1: