Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein RIM binding protein 2, RIMBP2 [117149] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117150] (2 PDB entries) Uniprot O15034 160-242 |
Domain d1wiea1: 1wie A:8-90 [114668] Other proteins in same PDB: d1wiea2, d1wiea3 Structural genomics target has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1wie (more details)
SCOPe Domain Sequences for d1wiea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiea1 b.34.2.1 (A:8-90) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} tskqrysgkvhlcvarysynpfdgpnenpeaelpltagkylyvygdmdedgfyegelldg qrglvpsnfvdfvqdnesrlast
Timeline for d1wiea1: