Lineage for d1wica1 (1wic A:8-146)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374559Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2374652Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 2374676Protein MSP domain containing protein 2, Mospd2 [117061] (1 species)
  7. 2374677Species Mouse (Mus musculus) [TaxId:10090] [117062] (1 PDB entry)
    Uniprot Q9CWP6 317-455
  8. 2374678Domain d1wica1: 1wic A:8-146 [114666]
    Other proteins in same PDB: d1wica2, d1wica3
    Structural genomics target

Details for d1wica1

PDB Entry: 1wic (more details)

PDB Description: solution structure of the msp domain of riken cdna 6030424e15
PDB Compounds: (A:) Hypothetical Protein RIKEN cDNA 6030424E15

SCOPe Domain Sequences for d1wica1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wica1 b.1.11.2 (A:8-146) MSP domain containing protein 2, Mospd2 {Mouse (Mus musculus) [TaxId: 10090]}
kkplsvfkgpllhispaeelyfgsiesgekktlivltnvtknivafkvrttapekyrvkp
snsscdpgasidiivsphggltvsaqdrflimaaemeqssgtgpaelsqfwkevprnkvm
ehrlrchtvesskpnslml

SCOPe Domain Coordinates for d1wica1:

Click to download the PDB-style file with coordinates for d1wica1.
(The format of our PDB-style files is described here.)

Timeline for d1wica1: