![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.2: MSP-like [49360] (4 proteins) Pfam PF00635 |
![]() | Protein MSP domain containing protein 2, Mospd2 [117061] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117062] (1 PDB entry) Uniprot Q9CWP6 317-455 |
![]() | Domain d1wica1: 1wic A:8-146 [114666] Other proteins in same PDB: d1wica2, d1wica3 Structural genomics target |
PDB Entry: 1wic (more details)
SCOPe Domain Sequences for d1wica1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wica1 b.1.11.2 (A:8-146) MSP domain containing protein 2, Mospd2 {Mouse (Mus musculus) [TaxId: 10090]} kkplsvfkgpllhispaeelyfgsiesgekktlivltnvtknivafkvrttapekyrvkp snsscdpgasidiivsphggltvsaqdrflimaaemeqssgtgpaelsqfwkevprnkvm ehrlrchtvesskpnslml
Timeline for d1wica1: