Lineage for d1wica_ (1wic A:)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.11: PapD-like [49354] (2 families) 
contains PP switch between strands D and C'
Family b.1.11.2: MSP-like [49360] (4 proteins)
Pfam 00635
Protein MSP domain containing protein 2, Mospd2 [117061] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [117062] (1 PDB entry) 
Domain d1wica_: 1wic A: [114666]
Structural genomics target
Details for d1wica_
PDB Entry: 1wic (more details)
PDB Description: solution structure of the msp domain of riken cdna 6030424e15
SCOP Domain Sequences for d1wica_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wica_ b.1.11.2 (A:) MSP domain containing protein 2, Mospd2 {Mouse (Mus musculus)}
gssgssgkkplsvfkgpllhispaeelyfgsiesgekktlivltnvtknivafkvrttap
ekyrvkpsnsscdpgasidiivsphggltvsaqdrflimaaemeqssgtgpaelsqfwke
vprnkvmehrlrchtvesskpnslmlsgpssg
SCOP Domain Coordinates for d1wica_:
Click to download the PDB-style file with coordinates for d1wica_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wica_:
- d1wica_ is new in SCOP 1.71
- d1wica_ appears in SCOP 1.73
- d1wica_ appears in the current release, SCOPe 2.08, called d1wica1
View in 3D