SCOPe 2.08: Domain d1wica1: 1wic A:8-146

Lineage for d1wica1 (1wic A:8-146)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.2: MSP-like [49360] (4 proteins)
   Pfam PF00635

6. Protein MSP domain containing protein 2, Mospd2 [117061] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117062] (1 PDB entry)
   Uniprot Q9CWP6 317-455

8. Domain d1wica1: 1wic A:8-146 [114666]
   Other proteins in same PDB: d1wica2, d1wica3
   Structural genomics target

Details for d1wica1

PDB Entry: 1wic

PDB Description: solution structure of the msp domain of riken cdna 6030424e15

PDB Compounds: (A:) Hypothetical Protein RIKEN cDNA 6030424E15

SCOPe Domain Sequences for d1wica1:

Sequence; same for both SEQRES and ATOM records:

>d1wica1 b.1.11.2 (A:8-146) MSP domain containing protein 2, Mospd2 {Mouse (Mus musculus) [TaxId: 10090]}
kkplsvfkgpllhispaeelyfgsiesgekktlivltnvtknivafkvrttapekyrvkp
snsscdpgasidiivsphggltvsaqdrflimaaemeqssgtgpaelsqfwkevprnkvm
ehrlrchtvesskpnslml

Timeline for d1wica1:

• d1wica1 first appeared in SCOP 1.71, called d1wica_
  
• d1wica1 appears in SCOPe 2.07