![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123 |
![]() | Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) ![]() |
![]() | Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins) Pfam PF03946 |
![]() | Protein 60S ribosomal protein L12 [117898] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117899] (1 PDB entry) Uniprot P35979 2-80 |
![]() | Domain d1wiba1: 1wib A:2-85 [114665] Other proteins in same PDB: d1wiba2, d1wiba3 Structural genomics target |
PDB Entry: 1wib (more details)
SCOPe Domain Sequences for d1wiba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiba1 d.47.1.1 (A:2-85) 60S ribosomal protein L12 {Mouse (Mus musculus) [TaxId: 10090]} ppkfdpnevkvvylrctggevgatsalapkigplglspkkvgddiakatgdwkglritvk ltiqnrqaqievvpsasalsgpss
Timeline for d1wiba1: