Lineage for d1wiaa_ (1wia A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402653Protein Ubiquitin-like protein bab25500 (2010008E23Rik) [117810] (1 species)
  7. 1402654Species Mouse (Mus musculus) [TaxId:10090] [117811] (1 PDB entry)
    Uniprot Q9D8C5 163-244
  8. 1402655Domain d1wiaa_: 1wia A: [114664]
    Structural genomics target

Details for d1wiaa_

PDB Entry: 1wia (more details)

PDB Description: Solution structure of mouse hypothetical ubiquitin-like protein BAB25500
PDB Compounds: (A:) hypothetical ubiquitin-like protein (RIKEN cDNA 2010008E23)

SCOPe Domain Sequences for d1wiaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]}
gssgssginvrlkflndteelavarpedtvgtlkskyfpgqesqmkliyqgrllqdpart
lsslnitnncvihchrsppgaavsgpsassgpssg

SCOPe Domain Coordinates for d1wiaa_:

Click to download the PDB-style file with coordinates for d1wiaa_.
(The format of our PDB-style files is described here.)

Timeline for d1wiaa_: