Lineage for d1wi9a_ (1wi9 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533862Family a.4.5.47: PCI domain (PINT motif) [109671] (2 proteins)
    Pfam 01399
  6. 533866Protein Hypothetical protein C20orf116 homolog [116793] (1 species)
  7. 533867Species Mouse (Mus musculus) [TaxId:10090] [116794] (1 PDB entry)
  8. 533868Domain d1wi9a_: 1wi9 A: [114663]
    Structural genomics target

Details for d1wi9a_

PDB Entry: 1wi9 (more details)

PDB Description: Solution structure of the PCI domain from mouse hypothetical protein AAH51541

SCOP Domain Sequences for d1wi9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus)}
gssgssgfltefinyikkskvvlledlafqmglrtqdainriqdlltegtltgviddrgk
fiyitpsgpssg

SCOP Domain Coordinates for d1wi9a_:

Click to download the PDB-style file with coordinates for d1wi9a_.
(The format of our PDB-style files is described here.)

Timeline for d1wi9a_: