Lineage for d1wi9a1 (1wi9 A:105-163)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983336Family a.4.5.47: PCI domain (PINT motif) [109671] (2 protein domains)
    Pfam PF01399
  6. 1983340Protein Hypothetical protein C20orf116 homolog [116793] (1 species)
  7. 1983341Species Mouse (Mus musculus) [TaxId:10090] [116794] (1 PDB entry)
    Uniprot Q80WW9 216-274
  8. 1983342Domain d1wi9a1: 1wi9 A:105-163 [114663]
    Other proteins in same PDB: d1wi9a2, d1wi9a3
    Structural genomics target

Details for d1wi9a1

PDB Entry: 1wi9 (more details)

PDB Description: Solution structure of the PCI domain from mouse hypothetical protein AAH51541
PDB Compounds: (A:) Protein C20orf116 homolog

SCOPe Domain Sequences for d1wi9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi9a1 a.4.5.47 (A:105-163) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]}
fltefinyikkskvvlledlafqmglrtqdainriqdlltegtltgviddrgkfiyitp

SCOPe Domain Coordinates for d1wi9a1:

Click to download the PDB-style file with coordinates for d1wi9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wi9a1: