| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
| Protein Eukaryotic translation initiation factor 4B [117973] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [117974] (1 PDB entry) Uniprot P23588 88-178 |
| Domain d1wi8a1: 1wi8 A:88-178 [114662] Other proteins in same PDB: d1wi8a2, d1wi8a3 Structural genomics target |
PDB Entry: 1wi8 (more details)
SCOPe Domain Sequences for d1wi8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wi8a1 d.58.7.1 (A:88-178) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}
srlpksppytaflgnlpydvteesikeffrglnisavrlprepsnperlkgfgyaefedl
dsllsalslneeslgnkrirvdvadqaqdkd
Timeline for d1wi8a1: