Lineage for d1wi8a1 (1wi8 A:88-178)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195095Protein Eukaryotic translation initiation factor 4B [117973] (1 species)
  7. 2195096Species Human (Homo sapiens) [TaxId:9606] [117974] (1 PDB entry)
    Uniprot P23588 88-178
  8. 2195097Domain d1wi8a1: 1wi8 A:88-178 [114662]
    Other proteins in same PDB: d1wi8a2, d1wi8a3
    Structural genomics target

Details for d1wi8a1

PDB Entry: 1wi8 (more details)

PDB Description: solution structure of the rna binding domain of eukaryotic initiation factor 4b
PDB Compounds: (A:) Eukaryotic translation initiation factor 4B

SCOPe Domain Sequences for d1wi8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi8a1 d.58.7.1 (A:88-178) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}
srlpksppytaflgnlpydvteesikeffrglnisavrlprepsnperlkgfgyaefedl
dsllsalslneeslgnkrirvdvadqaqdkd

SCOPe Domain Coordinates for d1wi8a1:

Click to download the PDB-style file with coordinates for d1wi8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wi8a1: