Lineage for d1wi8a_ (1wi8 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724343Protein Eukaryotic translation initiation factor 4B [117973] (1 species)
  7. 724344Species Human (Homo sapiens) [TaxId:9606] [117974] (1 PDB entry)
  8. 724345Domain d1wi8a_: 1wi8 A: [114662]
    Structural genomics target
    mutant

Details for d1wi8a_

PDB Entry: 1wi8 (more details)

PDB Description: solution structure of the rna binding domain of eukaryotic initiation factor 4b
PDB Compounds: (A:) Eukaryotic translation initiation factor 4B

SCOP Domain Sequences for d1wi8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}
gssgssgsrlpksppytaflgnlpydvteesikeffrglnisavrlprepsnperlkgfg
yaefedldsllsalslneeslgnkrirvdvadqaqdkdsgpssg

SCOP Domain Coordinates for d1wi8a_:

Click to download the PDB-style file with coordinates for d1wi8a_.
(The format of our PDB-style files is described here.)

Timeline for d1wi8a_: