| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (32 proteins) |
| Protein Eukaryotic translation initiation factor 4B [117973] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [117974] (1 PDB entry) |
| Domain d1wi8a_: 1wi8 A: [114662] Structural genomics target mutant |
PDB Entry: 1wi8 (more details)
SCOP Domain Sequences for d1wi8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens)}
gssgssgsrlpksppytaflgnlpydvteesikeffrglnisavrlprepsnperlkgfg
yaefedldsllsalslneeslgnkrirvdvadqaqdkdsgpssg
Timeline for d1wi8a_: