Lineage for d1wi5a1 (1wi5 A:186-291)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790143Protein S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) [117200] (1 species)
  7. 2790144Species Human (Homo sapiens) [TaxId:9606] [117201] (1 PDB entry)
    Uniprot Q14690 173-278
  8. 2790145Domain d1wi5a1: 1wi5 A:186-291 [114661]
    Other proteins in same PDB: d1wi5a2, d1wi5a3
    Structural genomics target
    has additional insertions and/or extensions that are not grouped together

Details for d1wi5a1

PDB Entry: 1wi5 (more details)

PDB Description: solution structure of the s1 rna binding domain from human hypothetical protein baa11502
PDB Compounds: (A:) RRP5 protein homolog

SCOPe Domain Sequences for d1wi5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi5a1 b.40.4.5 (A:186-291) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]}
knvnrvlsaealkpgmlltgtvssledhgylvdigvdgtraflpllkaqeyirqknkgak
lkvgqylncivekvkgnggvvslsvghsevstaiateqqswnlnnl

SCOPe Domain Coordinates for d1wi5a1:

Click to download the PDB-style file with coordinates for d1wi5a1.
(The format of our PDB-style files is described here.)

Timeline for d1wi5a1: