![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) [117200] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117201] (1 PDB entry) Uniprot Q14690 173-278 |
![]() | Domain d1wi5a1: 1wi5 A:186-291 [114661] Other proteins in same PDB: d1wi5a2, d1wi5a3 Structural genomics target has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1wi5 (more details)
SCOPe Domain Sequences for d1wi5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wi5a1 b.40.4.5 (A:186-291) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} knvnrvlsaealkpgmlltgtvssledhgylvdigvdgtraflpllkaqeyirqknkgak lkvgqylncivekvkgnggvvslsvghsevstaiateqqswnlnnl
Timeline for d1wi5a1: