Lineage for d1wi3a_ (1wi3 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634288Family a.4.1.1: Homeodomain [46690] (39 proteins)
    Pfam PF00046
  6. 634297Protein DNA-binding protein SATB2 [116776] (1 species)
  7. 634298Species Human (Homo sapiens) [TaxId:9606] [116777] (1 PDB entry)
  8. 634299Domain d1wi3a_: 1wi3 A: [114660]
    Structural genomics target

Details for d1wi3a_

PDB Entry: 1wi3 (more details)

PDB Description: solution structure of the homeodomain of kiaa1034 protein
PDB Compounds: (A:) DNA-binding protein SATB2

SCOP Domain Sequences for d1wi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgprsrtkislealgilqsfihdvglypdqeaihtlsaqldlpkhtiikffqnqr
yhvkhsgpssg

SCOP Domain Coordinates for d1wi3a_:

Click to download the PDB-style file with coordinates for d1wi3a_.
(The format of our PDB-style files is described here.)

Timeline for d1wi3a_: