Lineage for d1wi2a1 (1wi2 A:8-98)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786020Protein PDZ domain containing protein 11, Pdzk11 [117182] (1 species)
  7. 2786021Species Mouse (Mus musculus) [TaxId:10090] [117183] (1 PDB entry)
    Uniprot Q9CZG9 37-127
  8. 2786022Domain d1wi2a1: 1wi2 A:8-98 [114659]
    Other proteins in same PDB: d1wi2a2, d1wi2a3
    Structural genomics target

Details for d1wi2a1

PDB Entry: 1wi2 (more details)

PDB Description: solution structure of the pdz domain from riken cdna 2700099c19
PDB Compounds: (A:) RIKEN cDNA 2700099C19

SCOPe Domain Sequences for d1wi2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi2a1 b.36.1.1 (A:8-98) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]}
nneltqflprivtlkkppgaqlgfnirggkasqlgifiskvipdsdahraglqegdqvla
vndvdfqdiehskaveilktareismrvrff

SCOPe Domain Coordinates for d1wi2a1:

Click to download the PDB-style file with coordinates for d1wi2a1.
(The format of our PDB-style files is described here.)

Timeline for d1wi2a1: