![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.3: YcfA/nrd intein domain [54786] (3 families) ![]() |
![]() | Family d.50.3.2: YcfA-like [117905] (1 protein) Pfam PF07927 |
![]() | Protein Hypothetical protein TTHA1913 [117906] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [117907] (1 PDB entry) Uniprot Q5SH17 |
![]() | Domain d1whza_: 1whz A: [114656] Structural genomics target complexed with cl |
PDB Entry: 1whz (more details), 1.52 Å
SCOPe Domain Sequences for d1whza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whza_ d.50.3.2 (A:) Hypothetical protein TTHA1913 {Thermus thermophilus [TaxId: 274]} mwmpprpeevarklrrlgfvermakgghrlythpdgrivvvpfhsgelpkgtfkrilrda glteeefhnl
Timeline for d1whza_: