SCOPe 2.07: Domain d1whya1: 1why A:81-164

Lineage for d1whya1 (1why A:81-164)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Putative RNA-binding protein 15B, Rbm15b [117971] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117972] (1 PDB entry)
   Uniprot Q6PHZ5 81-164

8. Domain d1whya1: 1why A:81-164 [114655]
   Other proteins in same PDB: d1whya2, d1whya3
   Structural genomics target

Details for d1whya1

PDB Entry: 1why

PDB Description: solution structure of the rna recognition motif from hypothetical rna binding protein bc052180

PDB Compounds: (A:) hypothetical protein RIKEN cDNA 1810017N16

SCOPe Domain Sequences for d1whya1:

Sequence; same for both SEQRES and ATOM records:

>d1whya1 d.58.7.1 (A:81-164) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}
kigygkanpttrlwvgglgpntslaalarefdrfgsirtidhvkgdsfayiqyesldaaq
aacakmrgfplggpdrrlrvdfak

Timeline for d1whya1:

• d1whya1 first appeared in SCOP 1.71, called d1whya_
  
• d1whya1 appears in SCOPe 2.06
  
• d1whya1 appears in the current release, SCOPe 2.08