Lineage for d1whya_ (1why A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603934Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 603935Family d.58.7.1: Canonical RBD [54929] (32 proteins)
  6. 604063Protein Putative RNA-binding protein 15B, Rbm15b [117971] (1 species)
  7. 604064Species Mouse (Mus musculus) [TaxId:10090] [117972] (1 PDB entry)
  8. 604065Domain d1whya_: 1why A: [114655]
    Structural genomics target

Details for d1whya_

PDB Entry: 1why (more details)

PDB Description: solution structure of the rna recognition motif from hypothetical rna binding protein bc052180

SCOP Domain Sequences for d1whya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus)}
gssgssgkigygkanpttrlwvgglgpntslaalarefdrfgsirtidhvkgdsfayiqy
esldaaqaacakmrgfplggpdrrlrvdfaksgpssg

SCOP Domain Coordinates for d1whya_:

Click to download the PDB-style file with coordinates for d1whya_.
(The format of our PDB-style files is described here.)

Timeline for d1whya_: