Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (32 proteins) |
Protein Putative RNA-binding protein 15B, Rbm15b [117971] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117972] (1 PDB entry) |
Domain d1whya_: 1why A: [114655] Structural genomics target |
PDB Entry: 1why (more details)
SCOP Domain Sequences for d1whya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus)} gssgssgkigygkanpttrlwvgglgpntslaalarefdrfgsirtidhvkgdsfayiqy esldaaqaacakmrgfplggpdrrlrvdfaksgpssg
Timeline for d1whya_: