![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Putative RNA-binding protein 15B, Rbm15b [117971] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117972] (1 PDB entry) Uniprot Q6PHZ5 81-164 |
![]() | Domain d1whya1: 1why A:81-164 [114655] Other proteins in same PDB: d1whya2, d1whya3 Structural genomics target |
PDB Entry: 1why (more details)
SCOPe Domain Sequences for d1whya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whya1 d.58.7.1 (A:81-164) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} kigygkanpttrlwvgglgpntslaalarefdrfgsirtidhvkgdsfayiqyesldaaq aacakmrgfplggpdrrlrvdfak
Timeline for d1whya1: