SCOPe 2.05: Domain d1whxa_: 1whx A:

Lineage for d1whxa_ (1whx A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117970] (4 PDB entries)
   Uniprot Q8R3C6 399-484; 581-678

8. Domain d1whxa_: 1whx A: [114654]
   Structural genomics target; 4th RBD

Details for d1whxa_

PDB Entry: 1whx

PDB Description: solution structure of the second rna binding domain from hypothetical protein bab23448

PDB Compounds: (A:) hypothetical protein RIKEN CDNA 1200009A02

SCOPe Domain Sequences for d1whxa_:

Sequence; same for both SEQRES and ATOM records:

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgrsktvilaknlpagtlaaeiqetfsrfgslgrvllpeggitaivefleplear
kafrhlayskfhhvplylewapigvfgaapqkkdsqheqpaekaesgpssg

Timeline for d1whxa_:

• d1whxa_ first appeared in SCOP 1.71
  
• d1whxa_ appears in SCOPe 2.04
  
• d1whxa_ is called d1whxa1 in SCOPe 2.06
  
• d1whxa_ appears in the current release, SCOPe 2.08, called d1whxa1