Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117970] (4 PDB entries) Uniprot Q8R3C6 399-484; 581-678 |
Domain d1whxa_: 1whx A: [114654] Structural genomics target; 4th RBD |
PDB Entry: 1whx (more details)
SCOPe Domain Sequences for d1whxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} gssgssgrsktvilaknlpagtlaaeiqetfsrfgslgrvllpeggitaivefleplear kafrhlayskfhhvplylewapigvfgaapqkkdsqheqpaekaesgpssg
Timeline for d1whxa_: