Lineage for d1whxa_ (1whx A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1027963Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1028176Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species)
  7. 1028177Species Mouse (Mus musculus) [TaxId:10090] [117970] (4 PDB entries)
    Uniprot Q8R3C6 399-484; 581-678
  8. 1028181Domain d1whxa_: 1whx A: [114654]
    Structural genomics target; 4th RBD

Details for d1whxa_

PDB Entry: 1whx (more details)

PDB Description: solution structure of the second rna binding domain from hypothetical protein bab23448
PDB Compounds: (A:) hypothetical protein RIKEN CDNA 1200009A02

SCOPe Domain Sequences for d1whxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgrsktvilaknlpagtlaaeiqetfsrfgslgrvllpeggitaivefleplear
kafrhlayskfhhvplylewapigvfgaapqkkdsqheqpaekaesgpssg

SCOPe Domain Coordinates for d1whxa_:

Click to download the PDB-style file with coordinates for d1whxa_.
(The format of our PDB-style files is described here.)

Timeline for d1whxa_: