Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Poly(A)-specific ribonuclease PARN [117967] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117968] (1 PDB entry) Uniprot Q8VDG3 430-516; structure of the R3H domain (162-248) is also known (111031) |
Domain d1whva1: 1whv A:430-516 [114652] Other proteins in same PDB: d1whva2, d1whva3 Structural genomics target |
PDB Entry: 1whv (more details)
SCOPe Domain Sequences for d1whva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whva1 d.58.7.1 (A:430-516) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} gpdlqpkrdhvlhvtfpkewktsdlyqlfsafgniqiswiddtsafvslsqpeqvqiavn tskyaesyriqtyaeyvgkkqkgkqvk
Timeline for d1whva1: