SCOPe 2.06: Domain d1whva1: 1whv A:430-516

Lineage for d1whva1 (1whv A:430-516)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Poly(A)-specific ribonuclease PARN [117967] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117968] (1 PDB entry)
   Uniprot Q8VDG3 430-516; structure of the R3H domain (162-248) is also known (111031)

8. Domain d1whva1: 1whv A:430-516 [114652]
   Other proteins in same PDB: d1whva2, d1whva3
   Structural genomics target

Details for d1whva1

PDB Entry: 1whv

PDB Description: solution structure of the rna binding domain from hypothetical protein bab23382

PDB Compounds: (A:) Poly(A)-specific Ribonuclease

SCOPe Domain Sequences for d1whva1:

Sequence; same for both SEQRES and ATOM records:

>d1whva1 d.58.7.1 (A:430-516) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]}
gpdlqpkrdhvlhvtfpkewktsdlyqlfsafgniqiswiddtsafvslsqpeqvqiavn
tskyaesyriqtyaeyvgkkqkgkqvk

Timeline for d1whva1:

• d1whva1 first appeared in SCOP 1.71, called d1whva_
  
• d1whva1 was called d1whva_ in SCOPe 2.05
  
• d1whva1 appears in SCOPe 2.07
  
• d1whva1 appears in the current release, SCOPe 2.08