Lineage for d1whva1 (1whv A:430-516)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952065Protein Poly(A)-specific ribonuclease PARN [117967] (1 species)
  7. 2952066Species Mouse (Mus musculus) [TaxId:10090] [117968] (1 PDB entry)
    Uniprot Q8VDG3 430-516; structure of the R3H domain (162-248) is also known (111031)
  8. 2952067Domain d1whva1: 1whv A:430-516 [114652]
    Other proteins in same PDB: d1whva2, d1whva3
    Structural genomics target

Details for d1whva1

PDB Entry: 1whv (more details)

PDB Description: solution structure of the rna binding domain from hypothetical protein bab23382
PDB Compounds: (A:) Poly(A)-specific Ribonuclease

SCOPe Domain Sequences for d1whva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whva1 d.58.7.1 (A:430-516) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]}
gpdlqpkrdhvlhvtfpkewktsdlyqlfsafgniqiswiddtsafvslsqpeqvqiavn
tskyaesyriqtyaeyvgkkqkgkqvk

SCOPe Domain Coordinates for d1whva1:

Click to download the PDB-style file with coordinates for d1whva1.
(The format of our PDB-style files is described here.)

Timeline for d1whva1: