| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.9: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46915] (1 family) ![]() |
| Family a.4.9.1: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46916] (1 protein) |
| Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46917] (2 species) links two duplicated two-domain units formed by domains 1-2 and 4-5 |
| Species Mouse (Mus musculus) [TaxId:10090] [116815] (1 PDB entry) Uniprot Q8K1R3 273-363 |
| Domain d1whua1: 1whu A:274-364 [114651] Other proteins in same PDB: d1whua2, d1whua3 Structural genomics target |
PDB Entry: 1whu (more details)
SCOPe Domain Sequences for d1whua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whua1 a.4.9.1 (A:274-364) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Mouse (Mus musculus) [TaxId: 10090]}
pqkiftpsaeivkytkiiameklyavftdyehdkvsrdeavnkirldteehlkekfpevd
qfeiiesfnivakevfrsiilneykrcdgrd
Timeline for d1whua1: