SCOPe 2.08: Domain d1whua1: 1whu A:274-364

Lineage for d1whua1 (1whu A:274-364)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.9: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46915] (1 family)

5. Family a.4.9.1: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46916] (1 protein)

6. Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46917] (2 species)
   links two duplicated two-domain units formed by domains 1-2 and 4-5

7. Species Mouse (Mus musculus) [TaxId:10090] [116815] (1 PDB entry)
   Uniprot Q8K1R3 273-363

8. Domain d1whua1: 1whu A:274-364 [114651]
   Other proteins in same PDB: d1whua2, d1whua3
   Structural genomics target

Details for d1whua1

PDB Entry: 1whu

PDB Description: solution structure of the alpha-helical domain from mouse hypothetical pnpase

PDB Compounds: (A:) polynucleotide phosphorylase; 3'-5' RNA exonuclease

SCOPe Domain Sequences for d1whua1:

Sequence; same for both SEQRES and ATOM records:

>d1whua1 a.4.9.1 (A:274-364) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Mouse (Mus musculus) [TaxId: 10090]}
pqkiftpsaeivkytkiiameklyavftdyehdkvsrdeavnkirldteehlkekfpevd
qfeiiesfnivakevfrsiilneykrcdgrd

Timeline for d1whua1:

• d1whua1 first appeared in SCOP 1.71, called d1whua_
  
• d1whua1 appears in SCOPe 2.07