Lineage for d1whra1 (1whr A:133-243)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563801Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2564219Superfamily d.68.7: R3H domain [82708] (1 family) (S)
    possibly lacks the N-terminal strand of the common fold
  5. 2564220Family d.68.7.1: R3H domain [82709] (4 proteins)
    Pfam PF01424; predicted nucleic acid-binding domain
  6. 2564224Protein R3H domain protein KIAA1002 [118015] (1 species)
  7. 2564225Species Human (Homo sapiens) [TaxId:9606] [118016] (1 PDB entry)
    Uniprot Q9Y2K5 133-343
  8. 2564226Domain d1whra1: 1whr A:133-243 [114650]
    Other proteins in same PDB: d1whra2, d1whra3
    Structural genomics target

Details for d1whra1

PDB Entry: 1whr (more details)

PDB Description: solution structure of the r3h domain from human hypothetical protein baa76846
PDB Compounds: (A:) Hypothetical KIAA1002 protein

SCOPe Domain Sequences for d1whra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whra1 d.68.7.1 (A:133-243) R3H domain protein KIAA1002 {Human (Homo sapiens) [TaxId: 9606]}
tdstgidlheflvntlkknprdrmmllkleqeilefindnnnqfkkfpqmtsyhrmllhr
vaayfgmdhnvdqtgkaviinktsntripeqrfsehikdekntefqqrfil

SCOPe Domain Coordinates for d1whra1:

Click to download the PDB-style file with coordinates for d1whra1.
(The format of our PDB-style files is described here.)

Timeline for d1whra1: