Lineage for d1whra_ (1whr A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605490Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 605643Superfamily d.68.7: R3H domain [82708] (1 family) (S)
    possibly lacks the N-terminal strand of the common fold
  5. 605644Family d.68.7.1: R3H domain [82709] (3 proteins)
    Pfam 01424; predicted nucleic acid-binding domain
  6. 605648Protein R3H domain protein KIAA1002 [118015] (1 species)
  7. 605649Species Human (Homo sapiens) [TaxId:9606] [118016] (1 PDB entry)
  8. 605650Domain d1whra_: 1whr A: [114650]
    Structural genomics target

Details for d1whra_

PDB Entry: 1whr (more details)

PDB Description: solution structure of the r3h domain from human hypothetical protein baa76846

SCOP Domain Sequences for d1whra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whra_ d.68.7.1 (A:) R3H domain protein KIAA1002 {Human (Homo sapiens)}
gssgssgtdstgidlheflvntlkknprdrmmllkleqeilefindnnnqfkkfpqmtsy
hrmllhrvaayfgmdhnvdqtgkaviinktsntripeqrfsehikdekntefqqrfilsg
pssg

SCOP Domain Coordinates for d1whra_:

Click to download the PDB-style file with coordinates for d1whra_.
(The format of our PDB-style files is described here.)

Timeline for d1whra_: