![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.7: R3H domain [82708] (1 family) ![]() possibly lacks the N-terminal strand of the common fold |
![]() | Family d.68.7.1: R3H domain [82709] (4 proteins) Pfam PF01424; predicted nucleic acid-binding domain |
![]() | Protein R3H domain protein KIAA1002 [118015] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118016] (1 PDB entry) Uniprot Q9Y2K5 133-343 |
![]() | Domain d1whra1: 1whr A:133-243 [114650] Other proteins in same PDB: d1whra2, d1whra3 Structural genomics target has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1whr (more details)
SCOPe Domain Sequences for d1whra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whra1 d.68.7.1 (A:133-243) R3H domain protein KIAA1002 {Human (Homo sapiens) [TaxId: 9606]} tdstgidlheflvntlkknprdrmmllkleqeilefindnnnqfkkfpqmtsyhrmllhr vaayfgmdhnvdqtgkaviinktsntripeqrfsehikdekntefqqrfil
Timeline for d1whra1: