Lineage for d1whqa_ (1whq A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722458Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 722459Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 722460Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
    Pfam PF00035
  6. 722461Protein ATP-dependent RNA helicase A, Dhx9 [117901] (1 species)
    formerly hypothetical protein bab28848
  7. 722462Species Mouse (Mus musculus) [TaxId:10090] [117902] (2 PDB entries)
  8. 722464Domain d1whqa_: 1whq A: [114649]
    Structural genomics target; 1st dsRBD

Details for d1whqa_

PDB Entry: 1whq (more details)

PDB Description: Solution structure of the N-terminal dsRBD from hypothetical protein BAB28848
PDB Compounds: (A:) RNA helicase A

SCOP Domain Sequences for d1whqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgiknflyawcgkrkmtpayeiravgnknrqkfmcevrvegfnyagmgnstnkkd
aqsnaardfvnylvrinevkseevpavgivpppsgpssg

SCOP Domain Coordinates for d1whqa_:

Click to download the PDB-style file with coordinates for d1whqa_.
(The format of our PDB-style files is described here.)

Timeline for d1whqa_: