![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.10: Cap-Gly domain [74924] (2 families) ![]() |
![]() | Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
![]() | Protein Cylindromatosis tumour-suppressor Cyld [82065] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82066] (3 PDB entries) Uniprot Q9NQC7 125-206, 228-304, 460-550 |
![]() | Domain d1whma1: 1whm A:8-86 [114647] Other proteins in same PDB: d1whma2, d1whma3 Structural genomics target; 2nd CAP-Gly domain |
PDB Entry: 1whm (more details)
SCOPe Domain Sequences for d1whma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whma1 b.34.10.1 (A:8-86) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} ppleinsrvslkvgetiesgtvifcdvlpgkeslgyfvgvdmdnpignwdgrfdgvqlcs facvestillhindiipes
Timeline for d1whma1: