Lineage for d1whma1 (1whm A:8-86)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784898Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2784899Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2784915Protein Cylindromatosis tumour-suppressor Cyld [82065] (1 species)
  7. 2784916Species Human (Homo sapiens) [TaxId:9606] [82066] (3 PDB entries)
    Uniprot Q9NQC7 125-206, 228-304, 460-550
  8. 2784919Domain d1whma1: 1whm A:8-86 [114647]
    Other proteins in same PDB: d1whma2, d1whma3
    Structural genomics target; 2nd CAP-Gly domain

Details for d1whma1

PDB Entry: 1whm (more details)

PDB Description: solution structure of the 2nd cap-gly domain in human cylindromatosis tumor suppressor cyld
PDB Compounds: (A:) Cylindromatosis tumor suppressor CYLD

SCOPe Domain Sequences for d1whma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whma1 b.34.10.1 (A:8-86) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]}
ppleinsrvslkvgetiesgtvifcdvlpgkeslgyfvgvdmdnpignwdgrfdgvqlcs
facvestillhindiipes

SCOPe Domain Coordinates for d1whma1:

Click to download the PDB-style file with coordinates for d1whma1.
(The format of our PDB-style files is described here.)

Timeline for d1whma1: