SCOPe 2.07: Domain d1whka1: 1whk A:8-85

Lineage for d1whka1 (1whk A:8-85)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.10: Cap-Gly domain [74924] (2 families)

5. Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
   Pfam PF01302

6. Protein Restin-like protein 2, Rsnl2 [117164] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117165] (2 PDB entries)
   Uniprot Q8CI96 266-354; 617-696

8. Domain d1whka1: 1whk A:8-85 [114645]
   Other proteins in same PDB: d1whka2, d1whka3
   Structural genomics target; 3rd CAP-Gly domains

Details for d1whka1

PDB Entry: 1whk

PDB Description: solution structure of the 3rd cap-gly domain in mouse 1700024k14rik hypothetical protein

PDB Compounds: (A:) RIKEN cDNA 1700024K14

SCOPe Domain Sequences for d1whka1:

Sequence; same for both SEQRES and ATOM records:

>d1whka1 b.34.10.1 (A:8-85) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]}
egtvklhegsqvlltssnematvryvgptdfasgiwlglelrsakgkndgavgdkryftc
kpnygvlvrpsrvtyrgi

Timeline for d1whka1:

• d1whka1 first appeared in SCOP 1.71, called d1whka_
  
• d1whka1 appears in SCOPe 2.06
  
• d1whka1 appears in the current release, SCOPe 2.08