Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) |
Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
Protein Restin-like protein 2, Rsnl2 [117164] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117165] (2 PDB entries) Uniprot Q8CI96 266-354; 617-696 |
Domain d1whka1: 1whk A:8-85 [114645] Other proteins in same PDB: d1whka2, d1whka3 Structural genomics target; 3rd CAP-Gly domains |
PDB Entry: 1whk (more details)
SCOPe Domain Sequences for d1whka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whka1 b.34.10.1 (A:8-85) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} egtvklhegsqvlltssnematvryvgptdfasgiwlglelrsakgkndgavgdkryftc kpnygvlvrpsrvtyrgi
Timeline for d1whka1: