![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.10: Cap-Gly domain [74924] (2 families) ![]() |
![]() | Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
![]() | Protein Restin-like protein 2, Rsnl2 [117164] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117165] (2 PDB entries) Uniprot Q8CI96 266-354; 617-696 |
![]() | Domain d1whja1: 1whj A:8-96 [114644] Other proteins in same PDB: d1whja2, d1whja3 Structural genomics target; 2nd CAP-Gly domain |
PDB Entry: 1whj (more details)
SCOPe Domain Sequences for d1whja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whja1 b.34.10.1 (A:8-96) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} lpnsdhttsramltslglklgdrvviagqkvgtlrfcgttefasgqwagieldepegknn gsvgrvqyfkcapkygifaplskisklkd
Timeline for d1whja1: