Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (1 family) |
Family b.34.10.1: Cap-Gly domain [74925] (10 proteins) Pfam PF01302 |
Protein CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) [117162] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117163] (1 PDB entry) Uniprot Q9DB67 19-107 |
Domain d1whha_: 1whh A: [114643] Structural genomics target; fragment? |
PDB Entry: 1whh (more details)
SCOP Domain Sequences for d1whha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} gssgssgkspsspslgslqqregakaevgdqvlvagqkqgivrfygktdfapgywygiel dqptgkhdgsvfgvryftcaprhgvfapasriqrigsgpssg
Timeline for d1whha_: