![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein Regulator of G-protein signaling 3, RGS3 [117180] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117181] (1 PDB entry) Uniprot Q9DC04 18-94 |
![]() | Domain d1whda1: 1whd A:8-94 [114641] Other proteins in same PDB: d1whda2, d1whda3 Structural genomics target |
PDB Entry: 1whd (more details)
SCOPe Domain Sequences for d1whda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1whda1 b.36.1.1 (A:8-94) Regulator of G-protein signaling 3, RGS3 {Mouse (Mus musculus) [TaxId: 10090]} egdpengeklqitirrgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerp vehwkcvelaheirscpseiillvwrv
Timeline for d1whda1: