SCOPe 2.05: Domain d1whda_: 1whd A:

Lineage for d1whda_ (1whd A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Regulator of G-protein signaling 3, RGS3 [117180] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117181] (1 PDB entry)
   Uniprot Q9DC04 18-94

8. Domain d1whda_: 1whd A: [114641]
   Structural genomics target

Details for d1whda_

PDB Entry: 1whd

PDB Description: solution structure of the pdz domain of rgs3

PDB Compounds: (A:) Regulator of G-protein signaling 3

SCOPe Domain Sequences for d1whda_:

Sequence; same for both SEQRES and ATOM records:

>d1whda_ b.36.1.1 (A:) Regulator of G-protein signaling 3, RGS3 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgegdpengeklqitirrgkdgfgfticcdspvrvqavdsggpaeraglqqldtv
lqlnerpvehwkcvelaheirscpseiillvwrvsgpssg

Timeline for d1whda_:

• d1whda_ first appeared in SCOP 1.71
  
• d1whda_ appears in SCOPe 2.04
  
• d1whda_ is called d1whda1 in SCOPe 2.06
  
• d1whda_ appears in the current release, SCOPe 2.08, called d1whda1