SCOP 1.71: Domain d1whda_: 1whd A:

Lineage for d1whda_ (1whd A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (35 proteins)
   Pfam 00595

6. Protein Regulator of G-protein signaling 3, RGS3 [117180] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117181] (1 PDB entry)

8. Domain d1whda_: 1whd A: [114641]
   Structural genomics target

Details for d1whda_

PDB Entry: 1whd

PDB Description: solution structure of the pdz domain of rgs3

SCOP Domain Sequences for d1whda_:

Sequence; same for both SEQRES and ATOM records:

>d1whda_ b.36.1.1 (A:) Regulator of G-protein signaling 3, RGS3 {Mouse (Mus musculus)}
gssgssgegdpengeklqitirrgkdgfgfticcdspvrvqavdsggpaeraglqqldtv
lqlnerpvehwkcvelaheirscpseiillvwrvsgpssg

Timeline for d1whda_:

• d1whda_ is new in SCOP 1.71
  
• d1whda_ appears in SCOP 1.73
  
• d1whda_ appears in the current release, SCOPe 2.08, called d1whda1