Lineage for d1whda1 (1whd A:8-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786056Protein Regulator of G-protein signaling 3, RGS3 [117180] (2 species)
  7. 2786060Species Mouse (Mus musculus) [TaxId:10090] [117181] (1 PDB entry)
    Uniprot Q9DC04 18-94
  8. 2786061Domain d1whda1: 1whd A:8-94 [114641]
    Other proteins in same PDB: d1whda2, d1whda3
    Structural genomics target

Details for d1whda1

PDB Entry: 1whd (more details)

PDB Description: solution structure of the pdz domain of rgs3
PDB Compounds: (A:) Regulator of G-protein signaling 3

SCOPe Domain Sequences for d1whda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whda1 b.36.1.1 (A:8-94) Regulator of G-protein signaling 3, RGS3 {Mouse (Mus musculus) [TaxId: 10090]}
egdpengeklqitirrgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerp
vehwkcvelaheirscpseiillvwrv

SCOPe Domain Coordinates for d1whda1:

Click to download the PDB-style file with coordinates for d1whda1.
(The format of our PDB-style files is described here.)

Timeline for d1whda1: