SCOPe 2.05: Domain d1whba_: 1whb A:

Lineage for d1whba_ (1whb A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.4: Ubiquitin carboxyl-terminal hydrolase 8, USP8 [117586] (1 protein)
   automatically mapped to Pfam PF00581

6. Protein Ubiquitin carboxyl-terminal hydrolase 8, USP8 [117587] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117588] (2 PDB entries)
   Uniprot P40818 174-317

8. Domain d1whba_: 1whb A: [114639]
   Structural genomics target

Details for d1whba_

PDB Entry: 1whb

PDB Description: solution structure of the rhodanese-like domain in human ubiquitin specific protease 8 (ubp8)

PDB Compounds: (A:) kiaa0055

SCOPe Domain Sequences for d1whba_:

Sequence; same for both SEQRES and ATOM records:

>d1whba_ c.46.1.4 (A:) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgkcetkekgaitakelytmmtdknisliimdarrmqdyqdscilhslsvpeeai
spgvtaswieahlpddskdtwkkrgnveyvvlldwfssakdlqigttlrslkdalfkwes
ktvlrneplvleggyenwllcypqyttnakvsgpssg

Timeline for d1whba_:

• d1whba_ first appeared in SCOP 1.71
  
• d1whba_ appears in SCOPe 2.04
  
• d1whba_ is called d1whba1 in SCOPe 2.06
  
• d1whba_ appears in the current release, SCOPe 2.08, called d1whba1