SCOPe 2.07: Domain d1whaa1: 1wha A:8-99

Lineage for d1whaa1 (1wha A:8-99)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Scribble (KIAA0147) [101731] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101732] (6 PDB entries)
   Uniprot Q14160 680-951, 1096-1193 # structure of 1st PDZ domain is also known, 1XQ5

8. Domain d1whaa1: 1wha A:8-99 [114638]
   Other proteins in same PDB: d1whaa2, d1whaa3
   Structural genomics target; 2nd PDZ domain

Details for d1whaa1

PDB Entry: 1wha

PDB Description: solution structure of the second pdz domain of human scribble (kiaa0147 protein).

PDB Compounds: (A:) KIAA0147 protein

SCOPe Domain Sequences for d1whaa1:

Sequence; same for both SEQRES and ATOM records:

>d1whaa1 b.36.1.1 (A:8-99) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]}
rhvaclarserglgfsiaggkgstpyragdagifvsriaeggaahragtlqvgdrvlsin
gvdvtearhdhavslltaasptialllereag

Timeline for d1whaa1:

• d1whaa1 first appeared in SCOP 1.71, called d1whaa_
  
• d1whaa1 appears in SCOPe 2.06
  
• d1whaa1 appears in the current release, SCOPe 2.08