Lineage for d1whaa_ (1wha A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666739Protein Scribble (KIAA0147) [101731] (1 species)
  7. 666740Species Human (Homo sapiens) [TaxId:9606] [101732] (3 PDB entries)
  8. 666741Domain d1whaa_: 1wha A: [114638]
    Structural genomics target; 2nd PDZ domain

Details for d1whaa_

PDB Entry: 1wha (more details)

PDB Description: solution structure of the second pdz domain of human scribble (kiaa0147 protein).
PDB Compounds: (A:) KIAA0147 protein

SCOP Domain Sequences for d1whaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgrhvaclarserglgfsiaggkgstpyragdagifvsriaeggaahragtlqvg
drvlsingvdvtearhdhavslltaasptialllereagsgpssg

SCOP Domain Coordinates for d1whaa_:

Click to download the PDB-style file with coordinates for d1whaa_.
(The format of our PDB-style files is described here.)

Timeline for d1whaa_: