SCOP 1.71: Domain d1whaa_: 1wha A:

Lineage for d1whaa_ (1wha A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (35 proteins)
   Pfam 00595

6. Protein Scribble (KIAA0147) [101731] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101732] (2 PDB entries)

8. Domain d1whaa_: 1wha A: [114638]
   Structural genomics target; 2nd PDZ domain

Details for d1whaa_

PDB Entry: 1wha

PDB Description: solution structure of the second pdz domain of human scribble (kiaa0147 protein).

SCOP Domain Sequences for d1whaa_:

Sequence; same for both SEQRES and ATOM records:

>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens)}
gssgssgrhvaclarserglgfsiaggkgstpyragdagifvsriaeggaahragtlqvg
drvlsingvdvtearhdhavslltaasptialllereagsgpssg

Timeline for d1whaa_:

• d1whaa_ is new in SCOP 1.71
  
• d1whaa_ appears in SCOP 1.73
  
• d1whaa_ appears in the current release, SCOPe 2.08, called d1whaa1