Lineage for d1wh8a_ (1wh8 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537429Family a.35.1.7: CUT domain [116891] (3 proteins)
    Pfam 02376
  6. 537436Protein Homeobox protein Cux-2, CUTL2 [116892] (1 species)
  7. 537437Species Human (Homo sapiens) [TaxId:9606] [116893] (2 PDB entries)
  8. 537438Domain d1wh8a_: 1wh8 A: [114636]
    Structural genomics target; 3rd CUT domain

Details for d1wh8a_

PDB Entry: 1wh8 (more details)

PDB Description: solution structure of the third cut domain of human homeobox protein cux-2

SCOP Domain Sequences for d1wh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh8a_ a.35.1.7 (A:) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens)}
gssgssgysgsqapggiqeivamspeldtysitkrvkevltdnnlgqrlfgesilgltqg
svsdllsrpkpwhklslkgrepfvrmqlwlndphnveklrdmkklsgpssg

SCOP Domain Coordinates for d1wh8a_:

Click to download the PDB-style file with coordinates for d1wh8a_.
(The format of our PDB-style files is described here.)

Timeline for d1wh8a_: