SCOPe 2.08: Domain d1wh8a1: 1wh8 A:8-105

Lineage for d1wh8a1 (1wh8 A:8-105)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.7: CUT domain [116891] (5 proteins)
   Pfam PF02376

6. Protein Homeobox protein Cux-2, CUTL2 [116892] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116893] (3 PDB entries)
   Uniprot O14529 825-912; 966-1063

8. Domain d1wh8a1: 1wh8 A:8-105 [114636]
   Other proteins in same PDB: d1wh8a2, d1wh8a3
   Structural genomics target; 3rd CUT domain

Details for d1wh8a1

PDB Entry: 1wh8

PDB Description: solution structure of the third cut domain of human homeobox protein cux-2

PDB Compounds: (A:) Homeobox protein Cux-2

SCOPe Domain Sequences for d1wh8a1:

Sequence; same for both SEQRES and ATOM records:

>d1wh8a1 a.35.1.7 (A:8-105) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]}
ysgsqapggiqeivamspeldtysitkrvkevltdnnlgqrlfgesilgltqgsvsdlls
rpkpwhklslkgrepfvrmqlwlndphnveklrdmkkl

Timeline for d1wh8a1:

• d1wh8a1 first appeared in SCOP 1.71, called d1wh8a_
  
• d1wh8a1 appears in SCOPe 2.07