Lineage for d1wh8a1 (1wh8 A:8-105)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709677Family a.35.1.7: CUT domain [116891] (5 proteins)
    Pfam PF02376
  6. 2709688Protein Homeobox protein Cux-2, CUTL2 [116892] (1 species)
  7. 2709689Species Human (Homo sapiens) [TaxId:9606] [116893] (3 PDB entries)
    Uniprot O14529 825-912; 966-1063
  8. 2709691Domain d1wh8a1: 1wh8 A:8-105 [114636]
    Other proteins in same PDB: d1wh8a2, d1wh8a3
    Structural genomics target; 3rd CUT domain

Details for d1wh8a1

PDB Entry: 1wh8 (more details)

PDB Description: solution structure of the third cut domain of human homeobox protein cux-2
PDB Compounds: (A:) Homeobox protein Cux-2

SCOPe Domain Sequences for d1wh8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh8a1 a.35.1.7 (A:8-105) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]}
ysgsqapggiqeivamspeldtysitkrvkevltdnnlgqrlfgesilgltqgsvsdlls
rpkpwhklslkgrepfvrmqlwlndphnveklrdmkkl

SCOPe Domain Coordinates for d1wh8a1:

Click to download the PDB-style file with coordinates for d1wh8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wh8a1: