Lineage for d1wh7a1 (1wh7 A:8-74)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981149Family a.4.1.1: Homeodomain [46690] (41 protein domains)
    Pfam PF00046
  6. 1981328Protein ZF-HD homeobox protein At4g24660 [116774] (1 species)
  7. 1981329Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116775] (1 PDB entry)
    Uniprot Q9SB61 148-215
  8. 1981330Domain d1wh7a1: 1wh7 A:8-74 [114635]
    Other proteins in same PDB: d1wh7a2, d1wh7a3
    Structural genomics target

Details for d1wh7a1

PDB Entry: 1wh7 (more details)

PDB Description: Solution structure of homeobox domain of Arabidopsis thaliana hypothetical protein F22K18.140
PDB Compounds: (A:) ZF-HD homeobox family protein

SCOPe Domain Sequences for d1wh7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh7a1 a.4.1.1 (A:8-74) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
snpsssggttkrfrtkftaeqkekmlafaerlgwriqkhddvaveqfcaetgvrrqvlki
wmhnnkn

SCOPe Domain Coordinates for d1wh7a1:

Click to download the PDB-style file with coordinates for d1wh7a1.
(The format of our PDB-style files is described here.)

Timeline for d1wh7a1: