SCOPe 2.07: Domain d1wh6a1: 1wh6 A:8-95

Lineage for d1wh6a1 (1wh6 A:8-95)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.7: CUT domain [116891] (5 proteins)
   Pfam PF02376

6. Protein Homeobox protein Cux-2, CUTL2 [116892] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116893] (3 PDB entries)
   Uniprot O14529 825-912; 966-1063

8. Domain d1wh6a1: 1wh6 A:8-95 [114634]
   Other proteins in same PDB: d1wh6a2, d1wh6a3
   Structural genomics target; 2nd CUT domain

Details for d1wh6a1

PDB Entry: 1wh6

PDB Description: solution structure of the second cut domain of human homeobox protein cux-2

PDB Compounds: (A:) Homeobox protein Cux-2

SCOPe Domain Sequences for d1wh6a1:

Sequence; same for both SEQRES and ATOM records:

>d1wh6a1 a.35.1.7 (A:8-95) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]}
qyelymyrevdtleltrqvkeklakngicqrifgekvlglsqgsvsdmlsrpkpwskltq
kgrepfirmqlwlsdqlgqavgqqpgas

Timeline for d1wh6a1:

• d1wh6a1 first appeared in SCOP 1.71, called d1wh6a_
  
• d1wh6a1 appears in SCOPe 2.06
  
• d1wh6a1 appears in the current release, SCOPe 2.08