Lineage for d1wh6a_ (1wh6 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640241Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 640242Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 640478Family a.35.1.7: CUT domain [116891] (4 proteins)
    Pfam PF02376
  6. 640489Protein Homeobox protein Cux-2, CUTL2 [116892] (1 species)
  7. 640490Species Human (Homo sapiens) [TaxId:9606] [116893] (3 PDB entries)
  8. 640493Domain d1wh6a_: 1wh6 A: [114634]
    Structural genomics target; 2nd CUT domain

Details for d1wh6a_

PDB Entry: 1wh6 (more details)

PDB Description: solution structure of the second cut domain of human homeobox protein cux-2
PDB Compounds: (A:) Homeobox protein Cux-2

SCOP Domain Sequences for d1wh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh6a_ a.35.1.7 (A:) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgqyelymyrevdtleltrqvkeklakngicqrifgekvlglsqgsvsdmlsrpk
pwskltqkgrepfirmqlwlsdqlgqavgqqpgassgpssg

SCOP Domain Coordinates for d1wh6a_:

Click to download the PDB-style file with coordinates for d1wh6a_.
(The format of our PDB-style files is described here.)

Timeline for d1wh6a_: