SCOP 1.71: Domain d1wh6a_: 1wh6 A:

Lineage for d1wh6a_ (1wh6 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families)

5. Family a.35.1.7: CUT domain [116891] (3 proteins)
   Pfam 02376

6. Protein Homeobox protein Cux-2, CUTL2 [116892] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116893] (2 PDB entries)

8. Domain d1wh6a_: 1wh6 A: [114634]
   Structural genomics target; 2nd CUT domain

Details for d1wh6a_

PDB Entry: 1wh6

PDB Description: solution structure of the second cut domain of human homeobox protein cux-2

SCOP Domain Sequences for d1wh6a_:

Sequence; same for both SEQRES and ATOM records:

>d1wh6a_ a.35.1.7 (A:) Homeobox protein Cux-2, CUTL2 {Human (Homo sapiens)}
gssgssgqyelymyrevdtleltrqvkeklakngicqrifgekvlglsqgsvsdmlsrpk
pwskltqkgrepfirmqlwlsdqlgqavgqqpgassgpssg

Timeline for d1wh6a_:

• d1wh6a_ is new in SCOP 1.71
  
• d1wh6a_ appears in SCOP 1.73
  
• d1wh6a_ appears in the current release, SCOPe 2.08, called d1wh6a1